TRACK BRANDS ON AI
Monitor your brand, company, or product's online reputation in AI responses
Searching...
Loading...
It's taking longer than usual, we might be experiencing higher load.
Give it a few more seconds or try again in a moment.
Give it a few more seconds or try again in a moment.
Searching...
Loading...
What does AI know about Krystal Biotech Inc ?
What does OpenAI free version (gpt-3.5-turbo) know about Krystal Biotech Inc?
| Last request | 09.11.2023
(There is a high chance that below response is an AI hallucination) |
| Well Known | No |
| Description | Krystal Biotech Inc is a biopharmaceutical company that develops and commercializes gene therapies for patients with dermatological diseases. |
| Most Notable Achievements | Krystal Biotech Inc has developed a gene therapy that has been approved by the FDA for the treatment of a rare skin disorder. |
| The Most Negative Fact | Krystal Biotech Inc has yet to commercialize any of its gene therapies. |
| Competition | None |
| Share with friends |
Register your email below to unlock features!
Don't like the AI answers? Who can help me Change them?
What does OpenAI paid version (gpt-4) know about Krystal Biotech Inc?
| Request date | |
| Well Known | No |
| Description | Krystal Biotech Inc is a biotechnology company that focuses on developing gene therapies for rare diseases. |
| Most Notable Achievements | Krystal Biotech's gene therapy for dystrophic epidermolysis bullosa (DEB) has shown promising results in clinical trials, with patients experiencing significant wound healing and improved quality of life. |
| The Most Negative Fact | Krystal Biotech is a relatively new company and has yet to bring a product to market. |
| Competition | None |
| Share with friends |
What does Google AI (PaLM) know about Krystal Biotech Inc?
| Last request | 04.01.2024 |
| Well Known | no |
| Description | Krystal Biotech Inc. is a clinical-stage biopharmaceutical company focused on the development of novel, targeted therapies for the treatment of cancer. |
| Most Notable Achievements | The company's lead product candidate, KRYSTAL-105, is a novel, first-in-class, oral, small molecule inhibitor of the bromodomain and extra-terminal domain (BET) family of proteins. |
| The Most Negative Fact | The company has a limited product pipeline and is dependent on the success of its lead product candidate. |
| Competition | None |
What does Microsoft Bing AI know about Krystal Biotech Inc?
| Well Known | No |
| Description | ipe hiealaosr mm edact lozoc ndsstaa ppsemBondbsclrutm teectit averhcfgccrahahephetslaeiayigindml ieto tss arol npswteIra Kainyaii e.c eoo i |
| Most Notable Achievements | rany glnmr n ar t ey octedoDhyft oeacI dpsa kaeeitsr. FdtvthrehirKp rveibe tbfhptr n eoapd aste eashA a seheo lhen t Bedorae |
| The Most Negative Fact | eaoryniiKhshtiehf.atBgancmltt y otc me eaer yczps snicatsooIee l r ei |
| Competition | neNo |