Track AI Answers

What does AI know about a brand?

TRACK BRANDS ON AI

Monitor your brand, company, or product's online reputation in AI responses

What does AI know about Krystal Biotech Inc ?

What does OpenAI free version (gpt-3.5-turbo) know about Krystal Biotech Inc?

Last request 09.11.2023

(There is a high chance that below response is an AI hallucination)

Well Known No
Description Krystal Biotech Inc is a biopharmaceutical company that develops and commercializes gene therapies for patients with dermatological diseases.
Most Notable Achievements Krystal Biotech Inc has developed a gene therapy that has been approved by the FDA for the treatment of a rare skin disorder.
The Most Negative Fact Krystal Biotech Inc has yet to commercialize any of its gene therapies.
Competition None
Share with friends

Register your email below to unlock features!

Don't like the AI answers? Who can help me Change them?

What does OpenAI paid version (gpt-4) know about Krystal Biotech Inc?

Request date
Well Known No
Description Krystal Biotech Inc is a biotechnology company that focuses on developing gene therapies for rare diseases.
Most Notable Achievements Krystal Biotech's gene therapy for dystrophic epidermolysis bullosa (DEB) has shown promising results in clinical trials, with patients experiencing significant wound healing and improved quality of life.
The Most Negative Fact Krystal Biotech is a relatively new company and has yet to bring a product to market.
Competition None
Share with friends

What does Google AI (PaLM) know about Krystal Biotech Inc?

Last request 04.01.2024
Well Known no
Description Krystal Biotech Inc. is a clinical-stage biopharmaceutical company focused on the development of novel, targeted therapies for the treatment of cancer.
Most Notable Achievements The company's lead product candidate, KRYSTAL-105, is a novel, first-in-class, oral, small molecule inhibitor of the bromodomain and extra-terminal domain (BET) family of proteins.
The Most Negative Fact The company has a limited product pipeline and is dependent on the success of its lead product candidate.
Competition None

What does Microsoft Bing AI know about Krystal Biotech Inc?

Well Known No
Description ipe hiealaosr mm edact lozoc ndsstaa ppsemBondbsclrutm teectit averhcfgccrahahephetslaeiayigindml ieto tss arol npswteIra Kainyaii e.c eoo i
Most Notable Achievements rany glnmr n ar t ey octedoDhyft oeacI dpsa kaeeitsr. FdtvthrehirKp rveibe tbfhptr n eoapd aste eashA a seheo lhen t Bedorae
The Most Negative Fact eaoryniiKhshtiehf.atBgancmltt y otc me eaer yczps snicatsooIee l r ei
Competition neNo

Register your email below to unlock features!

By signing up or logging in you agree to our Terms and Privacy Policy.